Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501251 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mastermind-Like Domain Containing 1 (MAMLD1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CXorf6 antibody: synthetic peptide directed towards the N terminal of human CXorf6
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
SPFVVPQTTEVGLKGPTVPYYEKINSVPAVDQELQ
ELLEE LTKIQDPSPN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mastermind-like domain-containing 1 (MAMLD1 or CXorf6) transactivates the Hes3 promoter, augments testosterone production, and contains the SF1 target sequence.
Fukami M, Wada Y, Okada M, Kato F, Katsumata N, Baba T, Morohashi K, Laporte J, Kitagawa M, Ogata T
The Journal of biological chemistry 2008 Feb 29;283(9):5525-32
The Journal of biological chemistry 2008 Feb 29;283(9):5525-32
No comments: Submit comment
No validations: Submit validation data