HPA021032

HSD17B1 antibody from Sigma-Aldrich
EDH17B2, EDHB17, HSD17, MGC138140, SDR28C1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021032
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021032, RRID:AB_1844345
Product name
Anti-HSD17B1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021032
Antibody type
Polyclonal
Antigen
Estradiol 17-beta-dehydrogenase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIH
TFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALR
APKPTL
Storage
-20C
Provider Type Product Number
- No reagents -