HPA019239

OSGIN1 antibody from Sigma-Aldrich
BDGI, OKL38
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019239
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019239, RRID:AB_1854779
Product name
Anti-OSGIN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019239
Antibody type
Polyclonal
Antigen
Oxidative stress-induced growth inhibitor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGFLTRNQAQQPFSLWARNVVLATGTFDSPARLGI
PGEALPFIHHELSALEAATRVGAVTPASDPVLIIG
AGLSAADAVLYARHYNIP
Storage
-20C
Provider Type Product Number
- No reagents -