Antibody data

Product number
H00000843-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000843-M04, RRID:AB_1137122
Product name
CASP10 monoclonal antibody (M04), clone 3C9
Provider product page
Abnova Corporation - H00000843-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CASP10.
Antigen sequence
SFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLE
KSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQ
KKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELS
EGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEK
QGKIDEDNLTCLEDLCKTVVPKLLRNIEK
Isotype
IgG
Antibody clone number
3C9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -