HPA017059

CASP10 antibody from MilliporeSigma / Merck KGaA
MCH4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017059
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017059, RRID:AB_1846040
Product name
Anti-CASP10 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017059
Antibody type
Polyclonal
Antigen
Caspase-10 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDV
ENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLL
SEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLL
PTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDS
LPKTEMTSL
Storage
-20C
Provider Type Product Number
- No reagents -