HPA017059

CASP10 antibody from Sigma-Aldrich
MCH4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017059
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017059, RRID:AB_1846040
Product name
Anti-CASP10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017059
Antibody type
Polyclonal
Antigen
Caspase-10 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDV
ENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLL
SEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLL
PTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDS
LPKTEMTSL
Storage
-20C
Provider Type Product Number
- No reagents -