HPA017059

CASP10 antibody from Atlas Antibodies
MCH4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017059
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017059, RRID:AB_1233680
Product name
Anti-CASP10
Provider product page
Atlas Antibodies - HPA017059
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDV
ENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLL
SEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLL
PTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDS
LPKTEMTSL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -