HPA018479

AK2 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018479
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018479, RRID:AB_1844676
Product name
Anti-AK2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018479
Antibody type
Polyclonal
Antigen
Adenylate kinase 2, mitochondrial recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LAENFCVCHLATGDMLRAMVASGSELGKKLKATMD
AGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRT
VRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRR
Storage
-20C
Provider Type Product Number
- No reagents -