Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009013-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009013-M02, RRID:AB_1137486
- Product name
- TAF1C monoclonal antibody (M02), clone 3E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TAF1C.
- Antigen sequence
SLSGHVDPSEDTSSPHSPEWPPADALPLPPTTPPS
QELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPG
CATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKP
RMGF- Isotype
- IgG
- Antibody clone number
- 3E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TAF1C expression in transfected 293T cell line by TAF1C monoclonal antibody (M02), clone 3E6.Lane 1: TAF1C transfected lysate(85.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TAF1C is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol