H00009013-M02

TAF1C antibody from Abnova Corporation
MGC:39976, SL1, TAFI110, TAFI95

Antibody data

Product number
H00009013-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009013-M02, RRID:AB_1137486
Product name
TAF1C monoclonal antibody (M02), clone 3E6
Provider product page
Abnova Corporation - H00009013-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TAF1C.
Antigen sequence
SLSGHVDPSEDTSSPHSPEWPPADALPLPPTTPPS
QELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPG
CATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKP
RMGF
Isotype
IgG
Antibody clone number
3E6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -