Antibody data

Product number
H00009099-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009099-D01, RRID:AB_10715027
Product name
USP2 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00009099-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human USP2 protein.
Antigen sequence
MSQLSSTLKRYTESARYTDAHYAKSGYGAYTPSSY
GANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSS
LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGS
GLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKL
DSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLART
RKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQ
VPSQAPPSRVPEIISPTYRPIGRYTLWETGKGQAP
GPSRSSSPGRDGMNSKSAQGLAGLRNLGNTCFMNS
ILQCLSNTRELRDYCLQRLYMRDLHHGSNAHTALV
EEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRF
VGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPE
NLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK
SSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTL
MDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFS
IQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRD
LDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTA
YCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLF
YELASPPSRM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -