HPA007222

USP2 antibody from Atlas Antibodies
UBP41
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007222
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007222, RRID:AB_889035
Product name
Anti-USP2
Provider product page
Atlas Antibodies - HPA007222
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSD
LARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELC
TLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQA
PPSRVPEIISPTYR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -