HPA006777

USP2 antibody from Sigma-Aldrich
UBP41
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006777
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006777, RRID:AB_1080507
Product name
Anti-USP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006777
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQR
LYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDV
VSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDG
LHNEVNRVTLRPKSNPENLDHLP
Storage
-20C
Provider Type Product Number
- No reagents -