HPA006702

PSMD8 antibody from Sigma-Aldrich
HIP6, HYPF, Nin1p, p31, Rpn12, S14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006702
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006702, RRID:AB_1079710
Product name
Anti-PSMD8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006702
Antibody type
Polyclonal
Antigen
26S proteasome non-ATPase regulatory subunit 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLM
EGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIA
GCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRG
WVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEY
ARQ
Storage
-20C
Provider Type Product Number
- No reagents -