HPA006756

USP5 antibody from Sigma-Aldrich
IsoT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006756
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006756, RRID:AB_1080534
Product name
Anti-USP5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006756
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGE
YSKPVPESGDGERVPEQKEVQDGIAPRMFKALIGK
GHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPN
EVF
Storage
-20C
Provider Type Product Number
- No reagents -