Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406692 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Dihydrolipoamide Dehydrogenase (DLD) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAF
REANL AASFGKSINF- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Prevalence of asymptomatic sacroiliac joint dysfunction and its association with leg length discrepancies in male students in selected junior secondary schools in Ibadan.
The role of amino acids T148 and R281 in human dihydrolipoamide dehydrogenase.
Ayanniyi O, Raji FS, Adegoke BO
African journal of medicine and medical sciences 2008 Mar;37(1):37-42
African journal of medicine and medical sciences 2008 Mar;37(1):37-42
The role of amino acids T148 and R281 in human dihydrolipoamide dehydrogenase.
Wang YC, Wang ST, Li C, Chen LY, Liu WH, Chen PR, Chou MC, Liu TC
Journal of biomedical science 2008 Jan;15(1):37-46
Journal of biomedical science 2008 Jan;15(1):37-46
No comments: Submit comment
No validations: Submit validation data