HPA017743

PRSS16 antibody from Sigma-Aldrich
TSSP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017743
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017743, RRID:AB_2171834
Product name
Anti-PRSS16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017743
Antibody type
Polyclonal
Antigen
Thymus-specific serine protease precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQL
RSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCP
FSQLPALPSQLDLCEQVFGLSALSVAQAVAQTNSY
YGG
Storage
-20C
Provider Type Product Number
- No reagents -