HPA006287

USP20 antibody from Sigma-Aldrich
KIAA1003
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006287
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006287, RRID:AB_1080510
Product name
Anti-USP20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006287
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGR
GGGSSQAETELLIPDEAGRAISEKERMKDRKFSWG
QQRTNSEQVDEDADVDTAMAALDQPAEAQPPSPRS
SSPCRTPEPDNDAHLRSSS
Storage
-20C
Provider Type Product Number
- No reagents -