HPA006239

MBTPS1 antibody from Sigma-Aldrich
KIAA0091, PCSK8, S1P, SKI-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006239
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006239, RRID:AB_1853615
Product name
Anti-MBTPS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006239
Antibody type
Polyclonal
Antigen
Membrane-bound transcription factor site-1 protease precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGVVITQTFKDQGLEVLKQETAVVENVPILGLYQI
PAEGGGRIVLYGDSNCLDDSHRQKDCFWLLDALLQ
YTSYGVTPPSLSHSGNRQRPPSGAGSVTPERMEGN
HLHRYSKV
Storage
-20C
Provider Type Product Number
- No reagents -