Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309961 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-MAX Dimerization Protein 3 (MXD3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MXD3 antibody: synthetic peptide directed towards the N terminal of human MXD3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MEPLASNIQVLLQAAEFLERREREAEHGYASLCPH
RSPGP IHRRKKRPPQ- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mad3 and Mad4: novel Max-interacting transcriptional repressors that suppress c-myc dependent transformation and are expressed during neural and epidermal differentiation.
Regulation of Myc and Mad during epidermal differentiation and HPV-associated tumorigenesis.
Hurlin PJ, QuĂ©va C, Koskinen PJ, SteingrĂmsson E, Ayer DE, Copeland NG, Jenkins NA, Eisenman RN
The EMBO journal 1995 Nov 15;14(22):5646-59
The EMBO journal 1995 Nov 15;14(22):5646-59
Regulation of Myc and Mad during epidermal differentiation and HPV-associated tumorigenesis.
Hurlin PJ, Foley KP, Ayer DE, Eisenman RN, Hanahan D, Arbeit JM
Oncogene 1995 Dec 21;11(12):2487-501
Oncogene 1995 Dec 21;11(12):2487-501
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting