HPA006669

BCLAF1 antibody from Sigma-Aldrich
BTF, KIAA0164
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006669
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006669, RRID:AB_1078302
Product name
Anti-BCLAF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006669
Antibody type
Polyclonal
Antigen
Bcl-2-associated transcription factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLDRGNTRDKEASKEKGSEKGRAEGEWEDQEALDY
FSDKESGKQKFNDSEGDDTEETEDYRQFRKSVLAD
QGKSFATASHRNTEEEGLKYKSKVSLKGNRESDGF
REEKNYKLKETGYVVERPSTTKDKHKEED
Storage
-20C
Provider Type Product Number
- No reagents -