HPA018794

PDLIM7 antibody from Sigma-Aldrich
ENIGMA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018794
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018794, RRID:AB_1855155
Product name
Anti-PDLIM7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018794
Antibody type
Polyclonal
Antigen
PDZ and LIM domain protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTP
QEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTST
VLTR
Storage
-20C
Provider Type Product Number
- No reagents -