HPA006159

SOX30 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006159
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006159, RRID:AB_1080062
Product name
Anti-SOX30 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006159
Antibody type
Polyclonal
Antigen
Transcription factor SOX-30 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPSPVTLFQPSVSSAAQVAVQDPSLPVYPALPPQR
FTGPSQTDTHQLHSEATHTVKQPTPVSLESANRIS
SSASTAHARFATSTIQPPREYSSVSPCPRSAPIPQ
ASPIPHP
Storage
-20C
Provider Type Product Number
- No reagents -