HPA008788

TP53BP1 antibody from Sigma-Aldrich
53BP1, p202, TDRD30
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008788
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008788, RRID:AB_1078070
Product name
Anti-TP53BP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008788
Antibody type
Polyclonal
Antigen
Tumor suppressor p53-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHD
SCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENP
FQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQH
HSSAHNKDIALGVFDVVVTDPSCPASVLKCAEAL
Storage
-20C
Provider Type Product Number
- No reagents -