HPA006201

KDM5A antibody from Sigma-Aldrich
JARID1A, RBBP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006201
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006201, RRID:AB_1079160
Product name
Anti-JARID1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006201
Antibody type
Polyclonal
Antigen
Jumonji/ARID domain-containing protein 1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKD
LIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETC
ASVAQLLLSKKQKHRQSPDSGRTRTKLTVEELKAF
VQQLFSLPCVISQARQVKNLLDDVEEFHERAQEAM
MDETPDSSK
Storage
-20C
Provider Type Product Number
- No reagents -