H00001244-M01A

ABCC2 antibody from Abnova Corporation
CMOAT, cMRP, DJS, MRP2
No application information provided.

Antibody data

Product number
H00001244-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001244-M01A, RRID:AB_1203929
Product name
ABCC2 monoclonal antibody (M01A), clone 1C5
Provider product page
Abnova Corporation - H00001244-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ABCC2.
Antigen sequence
LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKR
ELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQS
QDALVLEDVEKKKKKSGTKKDVPKSWLMKA
Isotype
IgG
Antibody clone number
1C5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -