HPA004860

ABCC2 antibody from Sigma-Aldrich
CMOAT, cMRP, DJS, MRP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004860
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004860, RRID:AB_1844433
Product name
Anti-ABCC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004860
Antibody type
Polyclonal
Antigen
Canalicular multispecific organic anion transporter 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AFTSITLFNILRFPLSMLPMMISSMLQASVSTERL
EKYLGGDDLDTSAIRHDCNFDKAMQFSEASFTWEH
DSEATVRDVNLDIMAGQLVAVIGPVGSGKSSLISA
MLGEMENVHGHITIKGTTAYVPQQSWIQNGT
Storage
-20C
Provider Type Product Number
- No reagents -