HPA027030

WNT16 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027030
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027030, RRID:AB_10604004
Product name
Anti-WNT16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027030
Antibody type
Polyclonal
Antigen
wingless-type MMTV integration site family, member 16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIG
HLLKDKYENSIQISDKIKRKMRRREKDQRKIPIHK
DDLLYVNKSPNY
Storage
-20C
Provider Type Product Number
- No reagents -