HPA024369

NFATC2 antibody from Atlas Antibodies
NF-ATP, NFAT1, NFATp
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024369
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024369, RRID:AB_1854413
Product name
Anti-NFATC2
Provider product page
Atlas Antibodies - HPA024369
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSS
PDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMA
APLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQA
SPVIHYSPTN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -