Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183447 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Factor of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 (NFAT1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the N terminal of mouse NFATC2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFD
YDYLN PIEEEPIAHK- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Microglial phenotype is regulated by activity of the transcription factor, NFAT (nuclear factor of activated T cells).
Phenotypic modulation of human urinary tract stroma-derived fibroblasts by transforming growth factor beta3.
A tumor-suppressor function for NFATc3 in T-cell lymphomagenesis by murine leukemia virus.
Nagamoto-Combs K, Combs CK
The Journal of neuroscience : the official journal of the Society for Neuroscience 2010 Jul 14;30(28):9641-6
The Journal of neuroscience : the official journal of the Society for Neuroscience 2010 Jul 14;30(28):9641-6
Phenotypic modulation of human urinary tract stroma-derived fibroblasts by transforming growth factor beta3.
Heer R, Clarke N, Rigas AC, Cheek TR, Pickard R, Leung HY
Urology 2010 Aug;76(2):509.e13-20
Urology 2010 Aug;76(2):509.e13-20
A tumor-suppressor function for NFATc3 in T-cell lymphomagenesis by murine leukemia virus.
Glud SZ, Sørensen AB, Andrulis M, Wang B, Kondo E, Jessen R, Krenacs L, Stelkovics E, Wabl M, Serfling E, Palmetshofer A, Pedersen FS
Blood 2005 Nov 15;106(10):3546-52
Blood 2005 Nov 15;106(10):3546-52
No comments: Submit comment
No validations: Submit validation data