HPA024369

NFATC2 antibody from Sigma-Aldrich
NF-ATP, NFAT1, NFATp
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024369
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024369, RRID:AB_1854413
Product name
Anti-NFATC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024369
Antibody type
Polyclonal
Antigen
Nuclear factor of activated T-cells, cytoplasmic 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSS
PDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMA
APLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQA
SPVIHYSPTN
Storage
-20C
Provider Type Product Number
- No reagents -