HPA006566

TAF6 antibody from Atlas Antibodies
MGC:8964, TAF2E, TAFII70, TAFII80, TAFII85
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006566
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006566, RRID:AB_1080194
Product name
Anti-TAF6
Provider product page
Atlas Antibodies - HPA006566
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPEN
PPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQ
GATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSV
EQQLYYKEITEACVGSCEAKRAEALQSIATDPG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -