HPA006566

TAF6 antibody from Sigma-Aldrich
MGC:8964, TAF2E, TAFII70, TAFII80, TAFII85
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006566
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006566, RRID:AB_1080194
Product name
Anti-TAF6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006566
Antibody type
Polyclonal
Antigen
Transcription initiation factor TFIID subunit 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPEN
PPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQ
GATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSV
EQQLYYKEITEACVGSCEAKRAEALQSIATDPG
Storage
-20C
Provider Type Product Number
- No reagents -