Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA042328 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-FZD4
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein fragment
- Description
- Affinity purified using the antigen as affinity ligand.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
SAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKP
- Isotype
- IgG
- Vial size
- 110µl
- Storage
- For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Handling
- The antibody solution should be gently mixed before use.
Submitted references Multiplexed selectivity screening of anti-GPCR antibodies
Dahl L, Kotliar I, Bendes A, Dodig-Crnković T, Fromm S, Elofsson A, Uhlén M, Sakmar T, Schwenk J
Science Advances 2023;9(18)
Science Advances 2023;9(18)
No comments: Submit comment
No validations: Submit validation data