Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405393 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Frizzled Family Receptor 4 (FZD4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKR
GNGWV KPGKGSETVV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Impact of laminitis on the canonical Wnt signaling pathway in basal epithelial cells of the equine digital laminae.
A unique combination of male germ cell miRNAs coordinates gonocyte differentiation.
Spatio-temporal expression pattern of frizzled receptors after contusive spinal cord injury in adult rats.
Regulation of endothelial cell cytoskeletal reorganization by a secreted frizzled-related protein-1 and frizzled 4- and frizzled 7-dependent pathway: role in neovessel formation.
Wang L, Pawlak EA, Johnson PJ, Belknap JK, Eades S, Stack S, Cousin H, Black SJ
PloS one 2013;8(2):e56025
PloS one 2013;8(2):e56025
A unique combination of male germ cell miRNAs coordinates gonocyte differentiation.
McIver SC, Stanger SJ, Santarelli DM, Roman SD, Nixon B, McLaughlin EA
PloS one 2012;7(4):e35553
PloS one 2012;7(4):e35553
Spatio-temporal expression pattern of frizzled receptors after contusive spinal cord injury in adult rats.
Gonzalez P, Fernandez-Martos CM, Gonzalez-Fernandez C, Arenas E, Rodriguez FJ
PloS one 2012;7(12):e50793
PloS one 2012;7(12):e50793
Regulation of endothelial cell cytoskeletal reorganization by a secreted frizzled-related protein-1 and frizzled 4- and frizzled 7-dependent pathway: role in neovessel formation.
Dufourcq P, Leroux L, Ezan J, Descamps B, Lamazière JM, Costet P, Basoni C, Moreau C, Deutsch U, Couffinhal T, Duplàa C
The American journal of pathology 2008 Jan;172(1):37-49
The American journal of pathology 2008 Jan;172(1):37-49
No comments: Submit comment
No validations: Submit validation data