HPA027597

IL1R2 antibody from Sigma-Aldrich
CD121b, IL1RB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027597
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027597, RRID:AB_10600768
Product name
Anti-IL1R2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027597
Antibody type
Polyclonal
Antigen
interleukin 1 receptor, type II recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLW
ASVSPRINLTWHKNDSARTVPGEEETRMWAQD
Storage
-20C
Provider Type Product Number
- No reagents -