Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008586 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008586, RRID:AB_1080222
- Product name
- Anti-TBX2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAA
AAAAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPS
TSLLTTGLASEGSKAAGGNSREPSPLPELALRKVG
APSRGALSPSGSAKEAANELQSIQRLVSGL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Msx1 and Tbx2 antagonistically regulate Bmp4 expression during the bud-to-cap stage transition in tooth development.
The transcription factors TBX2 and TBX3 interact with human papillomavirus 16 (HPV16) L2 and repress the long control region of HPVs.
Saadi I, Das P, Zhao M, Raj L, Ruspita I, Xia Y, Papaioannou VE, Bei M
Development (Cambridge, England) 2013 Jul;140(13):2697-702
Development (Cambridge, England) 2013 Jul;140(13):2697-702
The transcription factors TBX2 and TBX3 interact with human papillomavirus 16 (HPV16) L2 and repress the long control region of HPVs.
Schneider MA, Scheffer KD, Bund T, Boukhallouk F, Lambert C, Cotarelo C, Pflugfelder GO, Florin L, Spoden GA
Journal of virology 2013 Apr;87(8):4461-74
Journal of virology 2013 Apr;87(8):4461-74
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong nuclear and cytoplasmic positivity in glandular cells.