Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003663-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003663-M03, RRID:AB_463887
- Product name
- IRF5 monoclonal antibody (M03), clone 1H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IRF5.
- Antigen sequence
TPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAA
RLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQF
KELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMH
PAGMQ- Isotype
- IgG
- Antibody clone number
- 1H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IRF5 monoclonal antibody (M03), clone 1H6 Western Blot analysis of IRF5 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IRF5 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to IRF5 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of IRF5 transfected lysate using anti-IRF5 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IRF5 MaxPab mouse polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol