Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003663-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003663-M05, RRID:AB_714752
- Product name
- IRF5 monoclonal antibody (M05), clone 2D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IRF5.
- Antigen sequence
TPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAA
RLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQF
KELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMH
PAGMQ- Isotype
- IgG
- Antibody clone number
- 2D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IRF5 monoclonal antibody (M05), clone 2D4 Western Blot analysis of IRF5 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to IRF5 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to IRF5 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.8 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol