Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486891 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon Regulatory Factor 5 (IRF5) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IRF5 antibody: synthetic peptide directed towards the middle region of human IRF5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
IFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEM
FSGEL SWSADSIRLQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Association of interferon regulatory factor 5 haplotypes, similar to that found in systemic lupus erythematosus, in a large subgroup of patients with rheumatoid arthritis.
Clinical trials update from European Society of Cardiology meeting 2008: TIME-CHF, BACH, BEAUTIFUL, GISSI-HF, and HOME-HF.
Dieguez-Gonzalez R, Calaza M, Perez-Pampin E, de la Serna AR, Fernandez-Gutierrez B, Castañeda S, Largo R, Joven B, Narvaez J, Navarro F, Marenco JL, Vicario JL, Blanco FJ, Fernandez-Lopez JC, Caliz R, Collado-Escobar MD, Carreño L, Lopez-Longo J, Cañete JD, Gomez-Reino JJ, Gonzalez A
Arthritis and rheumatism 2008 May;58(5):1264-74
Arthritis and rheumatism 2008 May;58(5):1264-74
Clinical trials update from European Society of Cardiology meeting 2008: TIME-CHF, BACH, BEAUTIFUL, GISSI-HF, and HOME-HF.
Coletta AP, Cullington D, Clark AL, Cleland JG
European journal of heart failure 2008 Dec;10(12):1264-7
European journal of heart failure 2008 Dec;10(12):1264-7
No comments: Submit comment
No validations: Submit validation data