HPA019230

CRAT antibody from Sigma-Aldrich
CAT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019230
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019230, RRID:AB_1847212
Product name
Anti-CRAT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019230
Antibody type
Polyclonal
Antigen
Carnitine O-acetyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLL
DYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIK
SDIEKAKQNLSIMIQDLDITVMVFHHFGKDF
Storage
-20C
Provider Type Product Number
- No reagents -