H00002068-B01P

ERCC2 antibody from Abnova Corporation
EM9, MAG, MGC102762, MGC126218, MGC126219, TFIIH, XPD

Antibody data

Product number
H00002068-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002068-B01P, RRID:AB_1573437
Product name
ERCC2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00002068-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ERCC2 protein.
Antigen sequence
MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAK
GHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKL
IYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFL
GLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTAS
YVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIY
NLDDLKALGRRQGWCPYFLARYSILHANVVVYSYH
YLLDPKIADLVSKELARKAVVVFDEAHNIDNVCID
SMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQR
LRDEYRRLVEGLREASAARETDAHLANPVLPDEVL
QEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVV
QESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHT
LEITDLADFSPLTLLANFATLVSTYAKGFTIIIEP
FDDRTPTIANPILHFSCMDASLAIKPVFERFQSVI
ITSGTLSPLDIYPKILDFHPVTMATFTMTLARVCL
CPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLL
EMSAVVPDGIVAFFTSYQYMESTVASWYEQGILEN
IQRNKLLFIETQDGAETSVALEKYQEACENGRGAI
LLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQS
RILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVG
RAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEH
LTDANLNLTVDEGVQVAKYFLRQMAQPFHREDQLG
LSLLSLEQLESEETLKRIEQIAQQL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -