ABIN504641
antibody from antibodies-online
Targeting: ERCC2
EM9, MAG, MGC102762, MGC126218, MGC126219, XPD
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504641 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 2 (ERCC2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ERCC2 antibody: synthetic peptide directed towards the N terminal of human ERCC2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKG
HGVLE MPSGTGKTVS- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Predictive biomarkers of chemotherapy efficacy in colorectal cancer: results from the UK MRC FOCUS trial.
Braun MS, Richman SD, Quirke P, Daly C, Adlard JW, Elliott F, Barrett JH, Selby P, Meade AM, Stephens RJ, Parmar MK, Seymour MT
Journal of clinical oncology : official journal of the American Society of Clinical Oncology 2008 Jun 1;26(16):2690-8
Journal of clinical oncology : official journal of the American Society of Clinical Oncology 2008 Jun 1;26(16):2690-8
No comments: Submit comment
No validations: Submit validation data