Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
- Flow cytometry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R32123 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- PPT1 Antibody
- Antibody type
- Polyclonal
- Antigen
- Amino acids KEDVYRNHSIFLADINQERGINESYKKNLMALKK of human PPT1 were used as the immunogen for the PPT1 antibody.
- Description
- Antigen affinity
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the PPT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of 1) rat brain, 2) rat liver, and human 3) 22RV1, 4) HeLa, 5) A431 and 6) SMMC lysate with PPT1 antibody. Expected/observed molecular weight ~34 kDa.
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC testing of FFPE human intestinal cancer tissue with PPT1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Flow cytometry testing of human SiHa cells with PPT1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPT1 antibody.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Flow cytometry testing of human U937 cells with PPT1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPT1 antibody.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Flow cytometry testing of human THP-1 cells with PPT1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PPT1 antibody.