Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501967 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ribonuclease, RNase A Family, 1 (Pancreatic) (RNASE1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the middle region of human RNASE1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
MHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGS
PYVPV HFDASVEDST- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The solution structure and dynamics of human pancreatic ribonuclease determined by NMR spectroscopy provide insight into its remarkable biological activities and inhibition.
Kövér KE, Bruix M, Santoro J, Batta G, Laurents DV, Rico M
Journal of molecular biology 2008 Jun 20;379(5):953-65
Journal of molecular biology 2008 Jun 20;379(5):953-65
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting