H00010284-B01P

SAP18 antibody from Abnova Corporation
2HOR0202, MGC27131, SAP18p

Antibody data

Product number
H00010284-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010284-B01P, RRID:AB_1580351
Product name
SAP18 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00010284-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SAP18 protein.
Antigen sequence
MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTT
NNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELT
SLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKE
IGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP
NRAPPPSGRMRPY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -