HPA011352

SAP18 antibody from Sigma-Aldrich
2HOR0202, MGC27131, SAP18p
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011352
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011352, RRID:AB_1856563
Product name
Anti-SAP18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011352
Antibody type
Polyclonal
Antigen
Histone deacetylase complex subunit SAP18 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHH
RMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEV
YPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMS
GRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPP
Storage
-20C
Provider Type Product Number
- No reagents -