Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503937 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Matrix Metallopeptidase 13 (Collagenase 3) (MMP13) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MMP13 antibody: synthetic peptide directed towards the middle region of human MMP13
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus
- Host
- Rabbit
- Antigen sequence
HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCD
PSLSL DAITSLRGET- Vial size
- 50 µg
Submitted references Controlled release of simvastatin from in situ forming hydrogel triggers bone formation in MC3T3-E1 cells.
Genetic polymorphisms of matrix metalloproteinase 12 and 13 genes are implicated in endometriosis progression.
Park YS, David AE, Park KM, Lin CY, Than KD, Lee K, Park JB, Jo I, Park KD, Yang VC
The AAPS journal 2013 Apr;15(2):367-76
The AAPS journal 2013 Apr;15(2):367-76
Genetic polymorphisms of matrix metalloproteinase 12 and 13 genes are implicated in endometriosis progression.
Borghese B, Chiche JD, Vernerey D, Chenot C, Mir O, Bijaoui G, Bonaiti-PelliƩ C, Chapron C
Human reproduction (Oxford, England) 2008 May;23(5):1207-13
Human reproduction (Oxford, England) 2008 May;23(5):1207-13
No comments: Submit comment
No validations: Submit validation data