HPA027588

CASP4 antibody from Sigma-Aldrich
ICE(rel)II, ICH-2, TX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027588
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027588, RRID:AB_10603781
Product name
Anti-CASP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027588
Antibody type
Polyclonal
Antigen
caspase 4, apoptosis-related cysteine peptidase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDA
KTEDKVRVMADSMQEKQRMAGQMLLQTFFNIDQIS
PNKKAHPNMEAGPPESGESTDALK
Storage
-20C
Provider Type Product Number
- No reagents -