H00084172-M10
antibody from Abnova Corporation
Targeting: POLR1B
FLJ10816, FLJ21921, RPA135, RPA2, Rpo1-2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084172-M10 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084172-M10, RRID:AB_875791
- Product name
- POLR1B monoclonal antibody (M10), clone 4H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant POLR1B.
- Antigen sequence
GEMLKAAGYNFYGTERLYSGISGLELEADIFIGVV
YYQRLRHMVSDKFQVRTTGARDRVTNQPIGGRNVQ
GGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVA
HVCVK- Isotype
- IgG
- Antibody clone number
- 4H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of POLR1B expression in transfected 293T cell line by POLR1B monoclonal antibody (M10), clone 4H6.Lane 1: POLR1B transfected lysate (Predicted MW: 128.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged POLR1B is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to POLR1B on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol