Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182713 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 3 (PSMC3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PSMC3 antibody: synthetic peptide directed towards the middle region of human PSMC3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
TKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVK
VIAAT NRVDILD- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Post-translationally modified S12, absent in transformed breast epithelial cells, is not associated with the 26S proteasome and is induced by proteasome inhibitor.
Thompson HG, Harris JW, Brody JP
International journal of cancer. Journal international du cancer 2004 Sep 1;111(3):338-47
International journal of cancer. Journal international du cancer 2004 Sep 1;111(3):338-47
No comments: Submit comment
No validations: Submit validation data