HPA006065

PSMC3 antibody from Sigma-Aldrich
TBP-1, TBP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006065
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006065, RRID:AB_1079706
Product name
Anti-PSMC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006065
Antibody type
Polyclonal
Antigen
26S protease regulatory subunit 6A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EFPMPNEEARARIMQIHSRKMNVSPDVNYEELARC
TDDFNGAQCKAVCVEAGMIALRRGATELTHEDYME
GILEVQAKKKANLQYY
Storage
-20C
Provider Type Product Number
- No reagents -